PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G1724
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 328aa    MW: 37087.3 Da    PI: 8.8684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G1724genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-182671147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
      Gh_D03G1724 26 RGHWRPAEDEKLRQLVQQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 71
                     899*****************************.***********996 PP

2Myb_DNA-binding60.34.1e-1978121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
      Gh_D03G1724  78 RRPFTEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 121
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4742172IPR017930Myb domain
SuperFamilySSF466897.86E-3024119IPR009057Homeodomain-like
SMARTSM007171.2E-142574IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-272779IPR009057Homeodomain-like
CDDcd001675.11E-142970No hitNo description
PfamPF139212.1E-172989No hitNo description
PROSITE profilePS5129428.36673127IPR017930Myb domain
SMARTSM007172.4E-1677125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2180126IPR009057Homeodomain-like
CDDcd001676.59E-880120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTELSLFHHL SMEDSSDDVK TTSCPRGHWR PAEDEKLRQL VQQYGAQNWN SIAEKLQGRS  60
GKSCRLRWFN QLDPRINRRP FTEEEEERLL AAHRIHGNKW ALIARLFPGR TDNAVKNHWH  120
VIMARKQREQ SKLCGKRSFQ DGLIDSKLCF APRKSRCQEG FSSRFGFGDS RIFEFQNPSK  180
DKIFSVTSSS STSSPSWTFA SSTSMASNNT SLVELSGRDH GLAMGGSNLL DQSLYKCHSN  240
ASAYCSSFRN FSAFGLPNYR RVVSSPFRYL GLENSNDVVK EESSSFTDNA SKLTDIRVAS  300
NSHQEQDDDS IKTKDVPFID FLGVGISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32261267107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5270820.0HQ527082.1 Gossypium herbaceum clone NBRI_B_1735 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461174.10.0PREDICTED: transcription factor MYB59-like
TrEMBLA0A0D2VC190.0A0A0D2VC19_G
STRINGPOPTR_0005s20870.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16592913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-63myb domain protein 52